Long R3 IGF-1 | Insulin-like Growth Factor-1, human

Full Name	Long R3 Insulin Like Growth Factor-1 Human Recombinant
Synonyms	long r3 igf-1, igf-1 long r3, igf-1 r3,igf long r3,r3 igf-1.
Source	E. coli
Amino Acid Sequence	MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA.
Molecular Weight	Recombinant Human Long R3 Insulin Like Growth Factor-1 protein was produced in E. coli as a non-glycosylated polypeptide chain containing 83 amino acids and shown to exhibit a Molecular Weight of approximately 9 kDa by SDS-PAGE.
Purity	>95% as determined by SDS-PAGE and HPLC
Endotoxin	Endotoxin level was found to be ≤ 0.1 ng/µg(1EU/µg) by a LAL gel clot method.
Formulation	Lyophilized from a PBS solution pH7.2, filtered with a membrane (0.2 µm)
Reconstitution	To reconstitute the protein, add sterile water to the lyophilized protein and make a preparation with a concentration ≥0.1mg/ml. The preparation can be diluted into other appropriate buffers if necessary. Cautions should be taken to avoid bacterial growth, resulting in potential contamination with endotoxin.
Stability	Once lyophilized, the protein is stable at room temperature (≈3 weeks) and at -20°C (≥ 2 years from the date of receipt).Upon reconstitution, it can be stored at 4°C (≤ 7 days) or at -20°C (≤ 6 months). For long term storage, please store at -80°C and the addition of a carrier protein (0.1% HSA or BSA) is recommended.Avoid frequent freeze-thaw cycles.
Biological Activity	The specific activity was determined by stimulating protein synthesis in L6 myoblasts to be ≤ 10 ng/ml (ED50), corresponding to a specific activity of 100,000 units/mg.
Usage	FOR LABORATORY RESEARCH USE ONLY. Not intended for diagnostic or therapeutic purposes.

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below: