Protein G Recombinant

Description	Recombinant streptococcal protein G lacking the albumin binding region thereby avoiding undesirable reactions with albumin, though the Fc binding domain is still present. The recombinant Protein G is produced in Escherichia coli using sequence from Streptococcus C1-C2-C3. The Protein G contains 196 amino acids (190-384) having a molecular mass of 21.6 kDa. The Protein-G migrates on SDS-PAGE around 32 kDa.
Amino Acid Sequence	MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE.
Purity	>96% as determined by SDS-PAGE and HPLC
Formulation	Sterile Filtered White lyophilized (freeze-dried) powder. Lyophilized white Powder containing no additives.
Stability	The lyophilized form of the protein is stable at room temperature for 3 weeks and at -20°C for at least 2 years from the date of receipt. Upon reconstitution, the protein should be stored at 4°C for no more than 7 days. The protein is stable at -20°C for six months. For long term storage, please store at -80°C and the addition of a carrier protein (0.1% HSA or BSA) is recommended. Please prevent freeze-thaw cycles.
Solubility	Reconstitution with deionized water or PBS.
Specificity	1. Binds with greater affinity to most mammalian immunoglobulins than Protein A, including human IgG3 and rat IgG2a. 2. Does not bind to human IgM, IgD and IgA.
Usage	LABORATORY RESEARCH USE ONLY. Not intended for diagnostic or therapeutic purposes.

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below: