HMGB1 (High mobility group box-1), Human Recombinant, E.coli
The high mobility group box-1 protein (HMGB1; also designated as HMG1 and amphoterin) is an exceptional member in the family of HMG-box proteins; is an abundantly occurring parental form of the HMG proteins. As a redox-sensitive protein, HMGB1 contains three cysteines (Cys23, 45, and 106). HMGB1 protein is integral to oxidative stress and downstream apoptosis or survival and causes activation of nicotinamide adenine dinucleotide phosphate oxidase and increased reactive oxygen species production in neutrophils. Accumulation of HMGB1 at sites of oxidative DNA damage can lead to repair of the DNA. HMGB1 functions are currently mainly associated with binding to the cell surface receptor RAGE (receptor for advanced glycation end products).
| Description | HMG1 Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 223 amino acids and having a molecular mass of 26 kDa. The HMGB-1 is purified by proprietary chromatographic techniques. |
| Synonyms | HMG1, HMG3, SBP-1, Amphoterin, HMGB1, High-Mobility Group Box 1. |
| Source | Escherichia Coli. |
| Amino Acid Sequence | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKT MSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFF LFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKY EKDIAAYRAKGKPDAAKKGVVKAEKSKKKEEEEDEEDEEDEEEEEDEEDEDE EEDDDDELEHHHHHH. |
| Purity | >96% as determined by SDS-PAGE and HPLC |
| Formulation | Sterile Filtered White lyophilized (freeze-dried) powder. The HMG1 (1 mg/ml) was lyophilized after extensive dialyses against 1x PBS pH-7.4. |
| Stability | The lyophilized form of the protein is stable at room temperature for 3 weeks and at -20°C for at least 2 years from the date of receipt. Upon reconstitution, the protein should be stored at 4°C for no more than 7 days. The protein is stable at -20°C for six months. For long term storage, please store at -80°C and the addition of a carrier protein (0.1% HSA or BSA) is recommended. Please prevent freeze-thaw cycles. |
| Solubility | It is recommended to reconstitute the lyophilized HMGB1 in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. |
| Usage | LABORATORY RESEARCH USE ONLY. Not intended for diagnostic or therapeutic purposes. |
Write a review
Your Name:Your Review: Note: HTML is not translated!
Rating: Bad Good
Enter the code in the box below:
Product Code: OT614
Availability: In Stock
Availability: In Stock
Price: $0.00
Ex Tax: $0.00
Ex Tax: $0.00
- OR -
