IL 1 alpha | Interleukin-1 alpha, Human

Full Name	Interleukin-1 alpha Human Recombinant
Synonyms	Hematopoietin-1, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL-1 alpha,IL1, IL-1A, IL1F1.
Source	E. coli
Amino Acid Sequence	SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAV KFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITG SETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILE NQA.
Molecular Weight	Interleukin-1 alpha Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 159 amino acids and having a molecular mass of 18 KDa.
Purity	>95% as determined by SDS-PAGE and HPLC
Endotoxin	Endotoxin level was found to be ≤ 0.1 ng/µg(1EU/µg) by LAL gel clot method.
Formulation	Lyophilized from 20mM Tris-HCL, pH=8, 5mM MgCl2 and 10% glycerol.
Reconstitution	To reconstitute the protein, add sterile water to the lyophilized protein and make a preparation with a concentration ≥0.1mg/ml. The preparation can be diluted into other appropriate buffers if necessary. Be cautious and avoid potential contamination with bacteria and endotoxin
Stability	The lyophilized form of the protein is stable at room temperature for 3 weeks and at -20°C for at least 2 years from the date of receipt. Upon reconstitution, the protein should be stored at 4°C for no more than 7 days. The protein is stable at -20°C for six months. For long term storage, please store at -80°C and the addition of a carrier protein (0.1% HSA or BSA) is recommended. Please prevent freeze-thaw cycles.
Biological Activity	The ED50 as determined by the dose-dependant stimulation of murine D10S cells is < 0.001 ng/ml, corresponding to a Specific Activity of 1,000MIU/mg.
Usage	LABORATORY RESEARCH USE ONLY. Not intended for diagnostic or therapeutic purposes.

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below: