ProNGF Human
Nerve growth factor (NGF) is a small secreted protein that is important for the growth, maintenance, and survival of certain target neurons (nerve cells). It also functions as a signaling molecule.Pro NGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein pro NGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer.
| Full Name | Pro-Nerve Growth Factor Human Recombinant |
| Synonyms | Human Pro-NGF, ProNGF |
| Source | Escherichia Coli. |
| Amino Acid Sequence | MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNI TVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRS SSHPIFHRGEFSVCDSVSVWVGKTTATDIKGKEVMVLGEVNINNSVFKQYFFET KCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTAC VCVLSRKAVR. |
| Molecular Weight | Pro-Nerve Growth Factor Human Recombinant produced in E.Coli is a non-glycosylated, polypeptide chain containing 222 amino acids and having a molecular mass of 49,738 Dalton. |
| Purity | Greater than 98.0% as determined by SDS-PAGE. |
| Formulation | The sterile protein solution contains 50mM sodium phosphate buffer pH 7.2, 150mM sodium chloride. |
| Stability | Pro-Nerve Growth Factor although stable at 15°C for 1 week, should be stored at -20°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
| Biological Activity | The activity of the protein can be measured by its stimulating effect on the proliferation of TF1 cells (Chevalier et al. 1994 Blood 83, 1479-85). EC50 130 卤 30 pM (TF1 cell assay). |
| Usage | LABORATORY RESEARCH USE ONLY. Not intended for diagnostic or therapeutic purposes. |
Write a review
Your Name:Your Review: Note: HTML is not translated!
Rating: Bad Good
Enter the code in the box below:
Product Code: NT113
Availability: In Stock
Availability: In Stock
Price: $0.00
Ex Tax: $0.00
Ex Tax: $0.00
- OR -
