Protein Phosphatase 1A Alpha Isoform Human Recombinant
Protein Phosphatase 2C alpha is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase dephosphorylates, and negatively regulates the activities of, MAP kinases and MAP kinase kinases. It has been shown to inhibit the activation of p38 and JNK kinase cascades induced by environmental stresses. This phosphatase can also dephosphorylate cyclin-dependent kinases, and thus may be involved in cell cycle control. Overexpression of this phosphatase is reported to activate the expression of the tumor suppressor gene TP53/p53, which leads to G2/M cell cycle arrest and apoptosis. Three alternatively spliced transcript variants encoding two distinct isoforms have been described.
Protein phosphatase 2C(PP2C?) is a Mn2+- or Mg2+-dependent protein serine/threonine phosphatase that is essential for regulating cellular stress response in eukaryotes.
Protein phosphatase 2C(PP2C?) is a Mn2+- or Mg2+-dependent protein serine/threonine phosphatase that is essential for regulating cellular stress response in eukaryotes.
Description | Protein Phosphatase 1A Alpha Isoform Human Recombinant produced is a single, non-glycosylated polypeptide chain containing 382 amino acids and having a molecular mass of 46.6KDa (containing His tag, T7 gene 10 leader, XpressTM Epitope). The protein coding region of PP2C? (amino acids 1-382) was cloned into an E. coli expression vector(BamHI/Hind? site). PPM1A was overexpressed in E. coli as a soluble His-tag fusion protein, and it was purified by conventional column chromatographic techniques. |
Synonyms | Protein phosphatase 1A, EC 3.1.3.16, Protein phosphatase 2C isoform alpha, PP2C-alpha, IA, PPM1A, PP2CA, MGC9201. |
Source | Escherichia Coli. |
Amino Acid Sequence | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWILMGAFLDKPKMEKHN AQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAG SQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTG FLEIDEHMRV MSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDH KPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQL VSPEPEVHDI ERSEEDDQFI ILACDGIWDVMGNEELCDFVRSRLEVTDDL EKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLEC RVEEIIKKQG EGVPDLVHVM RTLASENIPSLPPGGELASKRNVIEAVYNR LNPYKNDDTDSTSTDDMW. |
Purity | >96% as determined by SDS-PAGE and HPLC |
Activity | 8,000 U/mg. |
Formulation | Sterile filtered colorless solution. The protein (1mg/ml) In phosphate-buffered saline ( pH 7.4) |
Stability | The lyophilized form of the protein is stable at room temperature for 3 weeks and at -20°C for at least 2 years from the date of receipt. Upon reconstitution, the protein should be stored at 4°C for no more than 7 days. The protein is stable at -20°C for six months. For long term storage, please store at -80°C and the addition of a carrier protein (0.1% HSA or BSA) is recommended. Please prevent freeze-thaw cycles. |
Unit Definition | One unit will hydrolyze 1nanomole of p-nitrophenylphosphatate per minute at pH 7.4 at 37°C using 10mM of substrate. |
Usage | LABORATORY RESEARCH USE ONLY. Not intended for diagnostic or therapeutic purposes. |
Write a review
Your Name:Your Review: Note: HTML is not translated!
Rating: Bad Good
Enter the code in the box below:
Product Code: EN760
Availability: In Stock
Availability: In Stock
Price: $0.00
Ex Tax: $0.00
Ex Tax: $0.00
- OR -