MHC Class-I chain related gene A Human Recombinant

MICA (MHC class I chain-related gene A) is a transmembrane glycoprotein that functions as a ligand for human NKG2D. A closely related protein, MICB, shares 85% amino acid identity with MICA. These proteins are distantly related to the MHC class I proteins. They possess three extracellular Ig-like domains, but they have no capacity to bind peptide or interact with ?2-microglobulin. The genes encoding these proteins are found within the Major Histocompatibility Complex on human chromosome 6. The MICA locus is highly polymorphic with more than 50 recognized human alleles. MICA is absent from most cells but is frequently expressed in epithelial tumors and can be induced by bacterial and viral infections. MICA is a ligand for human NKG2D, an activating receptor expressed on NK cells, NKT cells, ? ? T cells, and CD8+ ? ? T cells. Recognition of MICA by NKG2D results in the activation of cytolytic activity and/or cytokine production by these effector cells. MICA recognition is involved in tumor surveillance, viral infections, and autoimmune diseases.
Description MICA Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 320 amino acids and having a molecular mass of 36kDa.
The sequence contains the full length extracellular domain of the mature human MICA (amino acid residues Ala23 – Gln308) The MICA is purified by proprietary chromatographic techniques.
Synonyms MHC class I polypeptide-related sequence A, MIC-A, MICA, PERB11.1, HLA-B, AS, HLAB, HLAC, SPDA1, HLA-B73, HLA-B-7301.
Source Escherichia Coli.
Amino Acid Sequence EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQ
GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQE
IRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAM
NVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVN
VTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLP
DGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSH.
Purity >96% as determined by SDS-PAGE and HPLC
Formulation Sterile Filtered White lyophilized (freeze-dried) powder.
Lyophilized from a concentrated (1mg/ml) solution containing no additives.
Stability The lyophilized form of the protein is stable at room temperature for 3 weeks and at -20°C for at least 2 years from the date of receipt. Upon reconstitution, the protein should be stored at 4°C for no more than 7 days. The protein is stable at -20°C for six months. For long term storage, please store at -80°C and the addition of a carrier protein (0.1% HSA or BSA) is recommended. Please prevent freeze-thaw cycles.
Biological Activity Measured by its ability to bind MICA antibody in a ELISA.
Solubility It is recommended to reconstitute the lyophilized MICA in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Usage LABORATORY RESEARCH USE ONLY. Not intended for diagnostic or therapeutic purposes.

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below:



Product Code: OT766
Availability: In Stock
Price: $0.00
Ex Tax: $0.00

Available Options